SCOP 1.59: Domain d1eoda_: 1eod A:

Lineage for d1eoda_ (1eod A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)

6. Protein Shaker potassium channel [54702] (1 species)

7. Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)

8. Domain d1eoda_: 1eod A: [38641]

Details for d1eoda_

PDB Entry: 1eod, 2.45 Å

PDB Description: crystal structure of the n136d mutant of a shaker t1 domain

SCOP Domain Sequences for d1eoda_:

Sequence; same for both SEQRES and ATOM records:

>d1eoda_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica)}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvdvpldvfseeikfyelgenaferyredegf

Timeline for d1eoda_:

• d1eoda_ first appeared (with stable ids) in SCOP 1.55
  
• d1eoda_ appears in SCOP 1.57
  
• d1eoda_ appears in SCOP 1.61
  
• d1eoda_ appears in the current release, SCOPe 2.08