Lineage for d6xvka_ (6xvk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589707Protein automated matches [190091] (20 species)
    not a true protein
  7. 2589831Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)
  8. 2590532Domain d6xvka_: 6xvk A: [386405]
    automated match to d4agda_
    complexed with o3e

Details for d6xvka_

PDB Entry: 6xvk (more details), 1.99 Å

PDB Description: crystal structure of the kdr (vegfr2) kinase domain in complex with a type-ii inhibitor bearing an acrylamide
PDB Compounds: (A:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d6xvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xvka_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathsehr
almselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykv
apedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgla
rdiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvk
ideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqana

SCOPe Domain Coordinates for d6xvka_:

Click to download the PDB-style file with coordinates for d6xvka_.
(The format of our PDB-style files is described here.)

Timeline for d6xvka_: