| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species) PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [56161] (30 PDB entries) |
| Domain d6xvka_: 6xvk A: [386405] automated match to d4agda_ complexed with o3e |
PDB Entry: 6xvk (more details), 1.99 Å
SCOPe Domain Sequences for d6xvka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xvka_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
pydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathsehr
almselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykv
apedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgla
rdiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvk
ideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqana
Timeline for d6xvka_: