Lineage for d1eofa_ (1eof A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903421Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 1903457Protein Shaker potassium channel [54702] (1 species)
  7. 1903458Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)
  8. 1903462Domain d1eofa_: 1eof A: [38640]
    mutant

Details for d1eofa_

PDB Entry: 1eof (more details), 2.38 Å

PDB Description: crystal structure of the n136a mutant of a shaker t1 domain
PDB Compounds: (A:) potassium channel kv1.1

SCOPe Domain Sequences for d1eofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eofa_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvavpldvfseeikfyelgenaferyredegf

SCOPe Domain Coordinates for d1eofa_:

Click to download the PDB-style file with coordinates for d1eofa_.
(The format of our PDB-style files is described here.)

Timeline for d1eofa_: