Lineage for d1eofa_ (1eof A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132737Fold d.42: POZ domain [54694] (1 superfamily)
  4. 132738Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 132752Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 132795Protein Shaker potassium channel [54702] (1 species)
  7. 132796Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)
  8. 132800Domain d1eofa_: 1eof A: [38640]

Details for d1eofa_

PDB Entry: 1eof (more details), 2.38 Å

PDB Description: crystal structure of the n136a mutant of a shaker t1 domain

SCOP Domain Sequences for d1eofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eofa_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica)}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvavpldvfseeikfyelgenaferyredegf

SCOP Domain Coordinates for d1eofa_:

Click to download the PDB-style file with coordinates for d1eofa_.
(The format of our PDB-style files is described here.)

Timeline for d1eofa_: