Lineage for d1eoea_ (1eoe A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79490Fold d.42: POZ domain [54694] (1 superfamily)
  4. 79491Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 79505Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 79548Protein Shaker potassium channel [54702] (1 species)
  7. 79549Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)
  8. 79551Domain d1eoea_: 1eoe A: [38638]

Details for d1eoea_

PDB Entry: 1eoe (more details), 1.7 Å

PDB Description: crystal structure of the v135r mutant of a shaker t1 domain

SCOP Domain Sequences for d1eoea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoea_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica)}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrprnvpldvfseeikfyelgenaferyredegf

SCOP Domain Coordinates for d1eoea_:

Click to download the PDB-style file with coordinates for d1eoea_.
(The format of our PDB-style files is described here.)

Timeline for d1eoea_: