SCOPe 2.08: Domain d1eoea_: 1eoe A:

Lineage for d1eoea_ (1eoe A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)

6. Protein Shaker potassium channel [54702] (1 species)

7. Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)

8. Domain d1eoea_: 1eoe A: [38638]
   mutant

Details for d1eoea_

PDB Entry: 1eoe, 1.7 Å

PDB Description: crystal structure of the v135r mutant of a shaker t1 domain

PDB Compounds: (A:) potassium channel kv1.1

SCOPe Domain Sequences for d1eoea_:

Sequence; same for both SEQRES and ATOM records:

>d1eoea_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrprnvpldvfseeikfyelgenaferyredegf

Timeline for d1eoea_:

• d1eoea_ first appeared (with stable ids) in SCOP 1.55
  
• d1eoea_ appears in SCOPe 2.07