Lineage for d1t1da_ (1t1d A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256353Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 256354Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 256370Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins)
  6. 256418Protein Shaker potassium channel [54702] (1 species)
  7. 256419Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)
  8. 256420Domain d1t1da_: 1t1d A: [38637]
    mutant

Details for d1t1da_

PDB Entry: 1t1d (more details), 1.51 Å

PDB Description: crystal structure of the tetramerization domain of the shaker potassium channel

SCOP Domain Sequences for d1t1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica)}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvnvpldvfseeikfyelgenaferyredegf

SCOP Domain Coordinates for d1t1da_:

Click to download the PDB-style file with coordinates for d1t1da_.
(The format of our PDB-style files is described here.)

Timeline for d1t1da_: