Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins) |
Protein Shaker potassium channel [54702] (1 species) |
Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries) |
Domain d1t1da_: 1t1d A: [38637] mutant |
PDB Entry: 1t1d (more details), 1.51 Å
SCOP Domain Sequences for d1t1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica)} ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy qsggrlrrpvnvpldvfseeikfyelgenaferyredegf
Timeline for d1t1da_: