SCOP 1.59: Domain d1t1da_: 1t1d A:

Lineage for d1t1da_ (1t1d A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)

6. Protein Shaker potassium channel [54702] (1 species)

7. Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)

8. Domain d1t1da_: 1t1d A: [38637]

Details for d1t1da_

PDB Entry: 1t1d, 1.51 Å

PDB Description: crystal structure of the tetramerization domain of the shaker potassium channel

SCOP Domain Sequences for d1t1da_:

Sequence; same for both SEQRES and ATOM records:

>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica)}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvnvpldvfseeikfyelgenaferyredegf

Timeline for d1t1da_:

• d1t1da_ first appeared (with stable ids) in SCOP 1.55
  
• d1t1da_ appears in SCOP 1.57
  
• d1t1da_ appears in SCOP 1.61
  
• d1t1da_ appears in the current release, SCOPe 2.08