Lineage for d6t5kc_ (6t5k C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603551Species Echinicola vietnamensis [TaxId:390884] [386363] (1 PDB entry)
  8. 2603552Domain d6t5kc_: 6t5k C: [386364]
    automated match to d1a8ta_
    complexed with edo, zn

Details for d6t5kc_

PDB Entry: 6t5k (more details), 1.33 Å

PDB Description: ecv-1 from echinicola vietnamensis. environmental metallo-beta- lactamases exhibit high enzymatic activity under zinc deprivation
PDB Compounds: (C:) Zn-dependent hydrolase, glyoxylase

SCOPe Domain Sequences for d6t5kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t5kc_ d.157.1.0 (C:) automated matches {Echinicola vietnamensis [TaxId: 390884]}
stftekevyssdkliikqvsphtyvhvsfldtdtfgkvacngmivisdgeavvfdtpsts
netsellsfleeeklqvnavvathfhldclggleafharnipsyafkntlslasqhdfpq
pqkgfsdeltlkvgtkavfvhyfgeghtqdnvigyfpddqvlfggclikangagkgnled
anveawpvtvnkistaypnlrlvipghgnwgdktllhytetlfk

SCOPe Domain Coordinates for d6t5kc_:

Click to download the PDB-style file with coordinates for d6t5kc_.
(The format of our PDB-style files is described here.)

Timeline for d6t5kc_: