Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Echinicola vietnamensis [TaxId:390884] [386363] (1 PDB entry) |
Domain d6t5kc_: 6t5k C: [386364] automated match to d1a8ta_ complexed with edo, zn |
PDB Entry: 6t5k (more details), 1.33 Å
SCOPe Domain Sequences for d6t5kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t5kc_ d.157.1.0 (C:) automated matches {Echinicola vietnamensis [TaxId: 390884]} stftekevyssdkliikqvsphtyvhvsfldtdtfgkvacngmivisdgeavvfdtpsts netsellsfleeeklqvnavvathfhldclggleafharnipsyafkntlslasqhdfpq pqkgfsdeltlkvgtkavfvhyfgeghtqdnvigyfpddqvlfggclikangagkgnled anveawpvtvnkistaypnlrlvipghgnwgdktllhytetlfk
Timeline for d6t5kc_: