Lineage for d6p4al2 (6p4a L:109-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2351429Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2351669Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 3086292Domain d6p4al2: 6p4a L:109-214 [386354]
    Other proteins in same PDB: d6p4ac_, d6p4al1
    automated match to d3hfml2
    mutant

Details for d6p4al2

PDB Entry: 6p4a (more details), 2.2 Å

PDB Description: hyhel10 fab complexed with hen egg lysozyme carrying two mutations (hel2x-rigid): r21q and r73e
PDB Compounds: (L:) HyHEL10 Fab light chain

SCOPe Domain Sequences for d6p4al2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p4al2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d6p4al2:

Click to download the PDB-style file with coordinates for d6p4al2.
(The format of our PDB-style files is described here.)

Timeline for d6p4al2:

  • d6p4al2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6p4al1
View in 3D
Domains from other chains:
(mouse over for more information)
d6p4ac_