Lineage for d6smpb2 (6smp B:266-426)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918075Species Photorhabdus luminescens [TaxId:243265] [386265] (2 PDB entries)
  8. 2918083Domain d6smpb2: 6smp B:266-426 [386351]
    automated match to d1tqya2
    complexed with lle

Details for d6smpb2

PDB Entry: 6smp (more details), 2.9 Å

PDB Description: antde:antf (holo): type ii pks acyl-carrier protein in complex with its ketosynthase bound to the hexaketide
PDB Compounds: (B:) PKS_KS domain-containing protein

SCOPe Domain Sequences for d6smpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6smpb2 c.95.1.0 (B:266-426) automated matches {Photorhabdus luminescens [TaxId: 243265]}
hiyaelagyasvnnayhmtdlpadgmamarcidmalkdaqispstvnyisahgsstaqnd
inesnaikfvlgesafgipinslksmtghalaaanaiesvalcleiekqyvhptinyqtp
dpdcdldyipnqgcsypiktalklssgfsgihsvivmravd

SCOPe Domain Coordinates for d6smpb2:

Click to download the PDB-style file with coordinates for d6smpb2.
(The format of our PDB-style files is described here.)

Timeline for d6smpb2: