Lineage for d1vcbe_ (1vcb E:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31889Fold d.42: POZ domain [54694] (1 superfamily)
  4. 31890Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 31891Family d.42.1.1: BTB/POZ domain [54696] (2 proteins)
  6. 31892Protein Elongin C [54699] (1 species)
  7. 31893Species Human (Homo sapiens) [TaxId:9606] [54700] (1 PDB entry)
  8. 31895Domain d1vcbe_: 1vcb E: [38634]
    Other proteins in same PDB: d1vcba_, d1vcbc_, d1vcbd_, d1vcbf_, d1vcbg_, d1vcbi_, d1vcbj_, d1vcbl_

Details for d1vcbe_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure
PDB Compounds: (E:)

SCOP Domain Sequences for d1vcbe_:

Sequence, based on SEQRES records: (download)

>d1vcbe_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens)}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d1vcbe_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens)}
myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

SCOP Domain Coordinates for d1vcbe_:

Click to download the PDB-style file with coordinates for d1vcbe_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbe_: