SCOPe 2.07: Domain d6qugc1: 6qug C:1-370

Lineage for d6qugc1 (6qug C:1-370)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (38 species)
   not a true protein

7. Species Tetrahymena thermophila [TaxId:312017] [386228] (1 PDB entry)

8. Domain d6qugc1: 6qug C:1-370 [386329]
   Other proteins in same PDB: d6quga2, d6qugb2, d6qugc2, d6qugd2, d6quge2, d6qugf2, d6qugg2, d6qugh2, d6qugi2, d6qugj2, d6qugk2, d6qugl2
   automated match to d5b3xa_
   complexed with cu, glc, na, pg4, pge, po4, so4

Details for d6qugc1

PDB Entry: 6qug, 2.7 Å

PDB Description: ghk tagged mbp-nup98(1-29)

PDB Compounds: (C:) Maltodextrin-binding protein,Nucleoporin, putative

SCOPe Domain Sequences for d6qugc1:

Sequence; same for both SEQRES and ATOM records:

>d6qugc1 c.94.1.1 (C:1-370) automated matches {Tetrahymena thermophila [TaxId: 312017]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsav
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqtnaaa

Timeline for d6qugc1:

• d6qugc1 is new in SCOPe 2.07-stable
  
• d6qugc1 appears in the current release, SCOPe 2.08