Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein automated matches [190140] (38 species) not a true protein |
Species Tetrahymena thermophila [TaxId:312017] [386228] (1 PDB entry) |
Domain d6qugc1: 6qug C:1-370 [386329] Other proteins in same PDB: d6quga2, d6qugb2, d6qugc2, d6qugd2, d6quge2, d6qugf2, d6qugg2, d6qugh2, d6qugi2, d6qugj2, d6qugk2, d6qugl2 automated match to d5b3xa_ complexed with cu, glc, na, pg4, pge, po4, so4 |
PDB Entry: 6qug (more details), 2.7 Å
SCOPe Domain Sequences for d6qugc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qugc1 c.94.1.1 (C:1-370) automated matches {Tetrahymena thermophila [TaxId: 312017]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsav nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa laaaqtnaaa
Timeline for d6qugc1: