SCOPe 2.07: Domain d6trha1: 6trh A:5-380

Lineage for d6trha1 (6trh A:5-380)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)

6. Protein automated matches [196672] (8 species)
   not a true protein

7. Species Paenibacillus barcinonensis [TaxId:198119] [386243] (7 PDB entries)

8. Domain d6trha1: 6trh A:5-380 [386322]
   Other proteins in same PDB: d6trha2, d6trhb2, d6trhc2, d6trhd2
   automated match to d2drsa_
   complexed with ahr, xyp; mutant

Details for d6trha1

PDB Entry: 6trh, 1.86 Å

PDB Description: structure of e70a mutant of rex8a from paenibacillus barcinonensis complexed with 3(3)-alpha-l-arabinofuranosyl-xylotetraose.

PDB Compounds: (A:) Reducing-end xylose-releasing exo-oligoxylanase Rex8A

SCOPe Domain Sequences for d6trha1:

Sequence; same for both SEQRES and ATOM records:

>d6trha1 a.102.1.2 (A:5-380) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
gkgaydtgtyanlfqrsgyredeikarleqtwndlfygdehtriyypvgddkgymldtgn
ddvrsagmsygmmmavqmdkkhefdrlwnyaytymqhtegrykdyfawhckpdgtrlspg
papdgeeffamalffasnrwgdgpapydyqaqarkilhaclhqgeqgegdpmwepsnrli
kfipelpfsdpsyhlphfyelfaqyaneqdrtfwkeaaeasraylrtachpvtglspeya
nydgtpapvqlhgdfrhfysdayrvaanvaldwewfrkdpwqvqqsnriqaffsdidvsd
yrrytiegepfnepalhpvgllatnamaslaadgpdadsfvkrfwntplrqgkrryydnc
lyfftmlalsgnyrvy

Timeline for d6trha1:

• d6trha1 is new in SCOPe 2.07-stable
  
• d6trha1 appears in the current release, SCOPe 2.08