![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain [54697] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54698] (2 PDB entries) |
![]() | Domain d1cs3a_: 1cs3 A: [38632] complexed with gol, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1cs3 (more details), 2 Å
SCOPe Domain Sequences for d1cs3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cs3a_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} gmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhrn sqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkml
Timeline for d1cs3a_: