Lineage for d6sudb1 (6sud B:6-380)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722149Protein automated matches [196672] (8 species)
    not a true protein
  7. 2722163Species Paenibacillus barcinonensis [TaxId:198119] [386243] (7 PDB entries)
  8. 2722165Domain d6sudb1: 6sud B:6-380 [386298]
    Other proteins in same PDB: d6suda2, d6sudb2
    automated match to d2drsa_
    complexed with edo, gol, xyp; mutant

Details for d6sudb1

PDB Entry: 6sud (more details), 1.74 Å

PDB Description: structure of l320a mutant of rex8a from paenibacillus barcinonensis complexed with xylose.
PDB Compounds: (B:) Reducing-end xylose-releasing exo-oligoxylanase Rex8A

SCOPe Domain Sequences for d6sudb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sudb1 a.102.1.2 (B:6-380) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
kgaydtgtyanlfqrsgyredeikarleqtwndlfygdehtriyypvgddkgymldtgnd
dvrsegmsygmmmavqmdkkhefdrlwnyaytymqhtegrykdyfawhckpdgtrlspgp
apdgeeffamalffasnrwgdgpapydyqaqarkilhaclhqgeqgegdpmwepsnrlik
fipelpfsdpsyhlphfyelfaqyaneqdrtfwkeaaeasraylrtachpvtglspeyan
ydgtpapvqlhgdfrhfysdayrvaanvaldwewfrkdpwqvqqsnriqaffsdidvsdy
rrytiegepfnepaahpvgllatnamaslaadgpdadsfvkrfwntplrqgkrryydncl
yfftmlalsgnyrvy

SCOPe Domain Coordinates for d6sudb1:

Click to download the PDB-style file with coordinates for d6sudb1.
(The format of our PDB-style files is described here.)

Timeline for d6sudb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6sudb2