SCOPe 2.06: Domain d1fm0e_: 1fm0 E:

Lineage for d1fm0e_ (1fm0 E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
   automatically mapped to Pfam PF02391

6. Protein Molybdopterin synthase subunit MoaE [54692] (1 species)

7. Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)

8. Domain d1fm0e_: 1fm0 E: [38629]
   Other proteins in same PDB: d1fm0d_
   complexed with MoaD
   complexed with cl

Details for d1fm0e_

PDB Entry: 1fm0, 1.45 Å

PDB Description: molybdopterin synthase (moad/moae)

PDB Compounds: (E:) molybdopterin convertin factor, subunit 2

SCOPe Domain Sequences for d1fm0e_:

Sequence, based on SEQRES records:

>d1fm0e_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records):

>d1fm0e_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

Timeline for d1fm0e_:

• d1fm0e_ first appeared (with stable ids) in SCOP 1.55
  
• d1fm0e_ appears in SCOPe 2.05
  
• d1fm0e_ appears in SCOPe 2.07
  
• d1fm0e_ appears in the current release, SCOPe 2.08