Lineage for d1fm0e_ (1fm0 E:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31812Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 31883Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (1 family) (S)
  5. 31884Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
  6. 31885Protein Molybdopterin synthase subunit MoaE [54692] (1 species)
  7. 31886Species Escherichia coli [TaxId:562] [54693] (2 PDB entries)
  8. 31887Domain d1fm0e_: 1fm0 E: [38629]
    Other proteins in same PDB: d1fm0d_

Details for d1fm0e_

PDB Entry: 1fm0 (more details), 1.45 Å

PDB Description: molybdopterin synthase (moad/moae)

SCOP Domain Sequences for d1fm0e_:

Sequence, based on SEQRES records: (download)

>d1fm0e_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records): (download)

>d1fm0e_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

SCOP Domain Coordinates for d1fm0e_:

Click to download the PDB-style file with coordinates for d1fm0e_.
(The format of our PDB-style files is described here.)

Timeline for d1fm0e_: