SCOP 1.71: Domain d1ffkf_: 1ffk F:

Lineage for d1ffkf_ (1ffk F:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families)

5. Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)

6. Protein Ribosomal protein L10e [54688] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (19 PDB entries)

8. Domain d1ffkf_: 1ffk F: [38628]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
   complexed with cd, k, mo3; mutant

Details for d1ffkf_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkf_:

Sequence; same for both SEQRES and ATOM records:

>d1ffkf_ d.41.4.1 (F:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgahfrnsikpaytrreyisgipgkgiaqfkmgnngagptypaqvenvvekpvqirhna
leaarnaanrfvqnsgaaanykfrirkfpfhvireqdgdgmrapfgksvgtaarshganh
dfiawvnpdpavefawrraymkvtptvnidsspagna

Timeline for d1ffkf_:

• d1ffkf_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffkf_ appears in SCOP 1.69
  
• d1ffkf_ appears in SCOP 1.73
  
• d1ffkf_ appears in the current release, SCOPe 2.08