Lineage for d6p4ba1 (6p4b A:1-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2345800Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2346399Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (231 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 3086199Domain d6p4ba1: 6p4b A:1-108 [386261]
    Other proteins in same PDB: d6p4ba2, d6p4bc_, d6p4bd_, d6p4bl2
    automated match to d3hfml1
    complexed with cl; mutant

Details for d6p4ba1

PDB Entry: 6p4b (more details), 1.9 Å

PDB Description: hyhel10 fab variant hyhel10-4x (heavy chain mutations l4f, y33h, s56n, and y58f) bound to hen egg lysozyme variant hel2x-flex (mutations r21q, r73e, c76s, and c94s)
PDB Compounds: (A:) HyHEL10 Fab light chain

SCOPe Domain Sequences for d6p4ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p4ba1 b.1.1.1 (A:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleikr

SCOPe Domain Coordinates for d6p4ba1:

Click to download the PDB-style file with coordinates for d6p4ba1.
(The format of our PDB-style files is described here.)

Timeline for d6p4ba1:

  • d6p4ba1 is new in SCOPe 2.07-stable