Lineage for d6quja1 (6quj A:2-230)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2939917Domain d6quja1: 6quj A:2-230 [386253]
    Other proteins in same PDB: d6quja2, d6qujd2
    automated match to d2b3pa_
    complexed with cro, cu, gol, so4

Details for d6quja1

PDB Entry: 6quj (more details), 1.68 Å

PDB Description: ghk tagged gfp variant
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d6quja1:

Sequence, based on SEQRES records: (download)

>d6quja1 d.22.1.1 (A:2-230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
krgeqlftgvvpilveldgdvnghrfsvrgegegdatngrltlrficttgrlpvpwptlv
ttlgygvqcfsrypdhmrrhdffksampegyvqertisfrddgtyrtravvrfegntlvn
rielrgtnfredgnilghrleynynshnvyitadrqrngiranftirhnvedgsvqlanh
yqqntpigngpvllpddhylstqtalsrdpnerrdhmvllefvtaagit

Sequence, based on observed residues (ATOM records): (download)

>d6quja1 d.22.1.1 (A:2-230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
krgeqlftgvvpilveldgdvnghrfsvrgegegdatngrltlrficttgrlpvpwptlv
ttlvqcfsrypdhmrrhdffksampegyvqertisfrddgtyrtravvrfegntlvnrie
lrgtnfredgnilghrleynynshnvyitadrqrngiranftirhnvedgsvqlanhyqq
ntpigngpvllpddhylstqtalsrdpnerrdhmvllefvtaagit

SCOPe Domain Coordinates for d6quja1:

Click to download the PDB-style file with coordinates for d6quja1.
(The format of our PDB-style files is described here.)

Timeline for d6quja1:

  • d6quja1 first appeared in SCOPe 2.07, called d6quja_

View in 3D
Domains from same chain:
(mouse over for more information)
d6quja2