Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (6 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries) Uniprot P42212 |
Domain d6quja1: 6quj A:2-230 [386253] Other proteins in same PDB: d6quja2, d6qujd2 automated match to d2b3pa_ complexed with cro, cu, gol, so4 |
PDB Entry: 6quj (more details), 1.68 Å
SCOPe Domain Sequences for d6quja1:
Sequence, based on SEQRES records: (download)
>d6quja1 d.22.1.1 (A:2-230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} krgeqlftgvvpilveldgdvnghrfsvrgegegdatngrltlrficttgrlpvpwptlv ttlgygvqcfsrypdhmrrhdffksampegyvqertisfrddgtyrtravvrfegntlvn rielrgtnfredgnilghrleynynshnvyitadrqrngiranftirhnvedgsvqlanh yqqntpigngpvllpddhylstqtalsrdpnerrdhmvllefvtaagit
>d6quja1 d.22.1.1 (A:2-230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} krgeqlftgvvpilveldgdvnghrfsvrgegegdatngrltlrficttgrlpvpwptlv ttlvqcfsrypdhmrrhdffksampegyvqertisfrddgtyrtravvrfegntlvnrie lrgtnfredgnilghrleynynshnvyitadrqrngiranftirhnvedgsvqlanhyqq ntpigngpvllpddhylstqtalsrdpnerrdhmvllefvtaagit
Timeline for d6quja1: