Lineage for d1tpta3 (1tpt A:336-440)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2189168Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2189169Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins)
  6. 2189174Protein Thymidine phosphorylase [54682] (2 species)
  7. 2189175Species Escherichia coli [TaxId:562] [54683] (7 PDB entries)
  8. 2189183Domain d1tpta3: 1tpt A:336-440 [38625]
    Other proteins in same PDB: d1tpta1, d1tpta2
    complexed with so4, tdr

Details for d1tpta3

PDB Entry: 1tpt (more details), 2.8 Å

PDB Description: three-dimensional structure of thymidine phosphorylase from escherichia coli at 2.8 angstroms resolution
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1tpta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise

SCOPe Domain Coordinates for d1tpta3:

Click to download the PDB-style file with coordinates for d1tpta3.
(The format of our PDB-style files is described here.)

Timeline for d1tpta3: