SCOPe 2.08: Domain d6shyb1: 6shy B:6-380

Lineage for d6shyb1 (6shy B:6-380)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)

6. Protein automated matches [196672] (8 species)
   not a true protein

7. Species Paenibacillus barcinonensis [TaxId:198119] [386243] (7 PDB entries)

8. Domain d6shyb1: 6shy B:6-380 [386244]
   Other proteins in same PDB: d6shya2, d6shyb2
   automated match to d2drsa_
   complexed with edo; mutant

Details for d6shyb1

PDB Entry: 6shy, 1.81 Å

PDB Description: structure of l320a/h321s double mutant of rex8a from paenibacillus barcinonensis

PDB Compounds: (B:) Reducing-end xylose-releasing exo-oligoxylanase Rex8A

SCOPe Domain Sequences for d6shyb1:

Sequence; same for both SEQRES and ATOM records:

>d6shyb1 a.102.1.2 (B:6-380) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
kgaydtgtyanlfqrsgyredeikarleqtwndlfygdehtriyypvgddkgymldtgnd
dvrsegmsygmmmavqmdkkhefdrlwnyaytymqhtegrykdyfawhckpdgtrlspgp
apdgeeffamalffasnrwgdgpapydyqaqarkilhaclhqgeqgegdpmwepsnrlik
fipelpfsdpsyhlphfyelfaqyaneqdrtfwkeaaeasraylrtachpvtglspeyan
ydgtpapvqlhgdfrhfysdayrvaanvaldwewfrkdpwqvqqsnriqaffsdidvsdy
rrytiegepfnepaaspvgllatnamaslaadgpdadsfvkrfwntplrqgkrryydncl
yfftmlalsgnyrvy

Timeline for d6shyb1:

• d6shyb1 first appeared in SCOPe 2.07