![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) ![]() |
![]() | Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins) |
![]() | Protein Thymidine phosphorylase [54682] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54683] (7 PDB entries) |
![]() | Domain d1azyb3: 1azy B:336-440 [38624] Other proteins in same PDB: d1azya1, d1azya2, d1azya4, d1azyb1, d1azyb2, d1azyb4 |
PDB Entry: 1azy (more details), 3 Å
SCOPe Domain Sequences for d1azyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azyb3 d.41.3.1 (B:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg qrplavihakdennwqeaakavkaaikladkapestptvyrrise
Timeline for d1azyb3:
![]() Domains from other chains: (mouse over for more information) d1azya1, d1azya2, d1azya3, d1azya4 |