Lineage for d1azya3 (1azy A:336-440)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2552135Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2552136Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins)
  6. 2552141Protein Thymidine phosphorylase [54682] (2 species)
  7. 2552142Species Escherichia coli [TaxId:562] [54683] (7 PDB entries)
  8. 2552148Domain d1azya3: 1azy A:336-440 [38623]
    Other proteins in same PDB: d1azya1, d1azya2, d1azya4, d1azyb1, d1azyb2, d1azyb4

Details for d1azya3

PDB Entry: 1azy (more details), 3 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1azya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azya3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise

SCOPe Domain Coordinates for d1azya3:

Click to download the PDB-style file with coordinates for d1azya3.
(The format of our PDB-style files is described here.)

Timeline for d1azya3: