Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [386171] (4 PDB entries) |
Domain d6pcbd2: 6pcb D:276-400 [386221] Other proteins in same PDB: d6pcba3, d6pcbb3, d6pcbc3, d6pcbd3 automated match to d3ss6a2 complexed with cl, coa, cso, gol; mutant |
PDB Entry: 6pcb (more details), 1.61 Å
SCOPe Domain Sequences for d6pcbd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pcbd2 c.95.1.0 (D:276-400) automated matches {Pseudomonas putida [TaxId: 160488]} tprarvlgmasggvaprvmgigpvpavrklterlgiavsdfdvielneafasqglavlre lgvaddapqvnpnggaialgaplgmsgarlvltalhqleksggrkglatmcvgvgqglal aierv
Timeline for d6pcbd2: