Class a: All alpha proteins [46456] (290 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.0: automated matches [191431] (1 protein) not a true family |
Protein automated matches [190621] (30 species) not a true protein |
Species Escherichia coli [TaxId:83333] [374641] (5 PDB entries) |
Domain d6p3ca_: 6p3c A: [386217] automated match to d1vdka_ complexed with flc; mutant |
PDB Entry: 6p3c (more details), 1.46 Å
SCOPe Domain Sequences for d6p3ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p3ca_ a.127.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad ivkigrahlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvg
Timeline for d6p3ca_: