Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
Protein automated matches [190782] (2 species) not a true protein |
Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (5 PDB entries) |
Domain d6o9ua2: 6o9u A:139-295 [386210] Other proteins in same PDB: d6o9ua1, d6o9ua3 automated match to d3zrsa2 complexed with ba, cl, k, pcw, tmo, z3p |
PDB Entry: 6o9u (more details), 2 Å
SCOPe Domain Sequences for d6o9ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o9ua2 b.1.18.16 (A:139-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq
Timeline for d6o9ua2: