Lineage for d2tpta3 (2tpt A:336-440)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647248Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 1647249Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins)
  6. 1647254Protein Thymidine phosphorylase [54682] (2 species)
  7. 1647255Species Escherichia coli [TaxId:562] [54683] (7 PDB entries)
  8. 1647259Domain d2tpta3: 2tpt A:336-440 [38621]
    Other proteins in same PDB: d2tpta1, d2tpta2
    complexed with so4

Details for d2tpta3

PDB Entry: 2tpt (more details), 2.6 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d2tpta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise

SCOPe Domain Coordinates for d2tpta3:

Click to download the PDB-style file with coordinates for d2tpta3.
(The format of our PDB-style files is described here.)

Timeline for d2tpta3: