Lineage for d2tpt_3 (2tpt 336-440)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) 
Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (1 family) 
Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins) 
Protein Thymidine phosphorylase [54682] (1 species) Species Escherichia coli [TaxId:562] [54683] (4 PDB entries) 
Domain d2tpt_3: 2tpt 336-440 [38621]
Other proteins in same PDB: d2tpt_1, d2tpt_2
Details for d2tpt_3
PDB Entry: 2tpt (more details), 2.6 Å
PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
SCOP Domain Sequences for d2tpt_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tpt_3 d.41.3.1 (336-440) Thymidine phosphorylase {Escherichia coli}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise
SCOP Domain Coordinates for d2tpt_3:
Click to download the PDB-style file with coordinates for d2tpt_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tpt_3:
- d2tpt_3 appears in SCOP 1.57
- d2tpt_3 appears in the current release, SCOPe 2.08, called d2tpta3
View in 3D
