Lineage for d2tpta3 (2tpt A:336-440)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) 
Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins) Protein Thymidine phosphorylase [54682] (2 species) Species Escherichia coli [TaxId:562] [54683] (7 PDB entries) 
Domain d2tpta3: 2tpt A:336-440 [38621]
Other proteins in same PDB: d2tpta1, d2tpta2, d2tpta4
complexed with so4
Details for d2tpta3
PDB Entry: 2tpt (more details), 2.6 Å
PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:) thymidine phosphorylaseSCOPe Domain Sequences for d2tpta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise
SCOPe Domain Coordinates for d2tpta3:
Click to download the PDB-style file with coordinates for d2tpta3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tpta3:
- d2tpta3 first appeared (with stable ids) in SCOP 1.55, called d2tpt_3
- d2tpta3 appears in SCOPe 2.07
View in 3D
