Lineage for d6p4bd_ (6p4b D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2495039Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2495103Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2495111Species Chicken (Gallus gallus) [TaxId:9031] [53962] (854 PDB entries)
    Uniprot P00698
  8. 3086131Domain d6p4bd_: 6p4b D: [386193]
    Other proteins in same PDB: d6p4ba1, d6p4ba2, d6p4bl1, d6p4bl2
    automated match to d2vb1a_
    complexed with cl; mutant

Details for d6p4bd_

PDB Entry: 6p4b (more details), 1.9 Å

PDB Description: hyhel10 fab variant hyhel10-4x (heavy chain mutations l4f, y33h, s56n, and y58f) bound to hen egg lysozyme variant hel2x-flex (mutations r21q, r73e, c76s, and c94s)
PDB Compounds: (D:) Lysozyme C

SCOPe Domain Sequences for d6p4bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p4bd_ d.2.1.2 (D:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrhgldnyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsenlsnipcsallssditasvnsakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOPe Domain Coordinates for d6p4bd_:

Click to download the PDB-style file with coordinates for d6p4bd_.
(The format of our PDB-style files is described here.)

Timeline for d6p4bd_:

  • d6p4bd_ is new in SCOPe 2.07-stable