SCOPe 2.07: Domain d6o9vb2: 6o9v B:138-295

Lineage for d6o9vb2 (6o9v B:138-295)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [231564] (2 PDB entries)

8. Domain d6o9vb2: 6o9v B:138-295 [386157]
   Other proteins in same PDB: d6o9va1, d6o9va3, d6o9vb1, d6o9vb3
   automated match to d2x6ca2
   complexed with ddq, k, m1m, tmo; mutant

Details for d6o9vb2

PDB Entry: 6o9v, 3.09 Å

PDB Description: kirbac3.1 mutant at a resolution of 3.1 angstroms

PDB Compounds: (B:) Inward rectifier potassium channel Kirbac3.1

SCOPe Domain Sequences for d6o9vb2:

Sequence; same for both SEQRES and ATOM records:

>d6o9vb2 b.1.18.0 (B:138-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
ptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhd
ltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvhar
hayssdeiiwgghfvdvfttlpdgrraldlgkfheiaq

Timeline for d6o9vb2:

• d6o9vb2 is new in SCOPe 2.07-stable
  
• d6o9vb2 appears in the current release, SCOPe 2.08