SCOPe 2.08: Domain d6o9vb1: 6o9v B:11-137

Lineage for d6o9vb1 (6o9v B:11-137)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.0: automated matches [231560] (1 protein)
   not a true family

6. Protein automated matches [231561] (3 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [231562] (2 PDB entries)

8. Domain d6o9vb1: 6o9v B:11-137 [386156]
   Other proteins in same PDB: d6o9va2, d6o9va3, d6o9vb2, d6o9vb3
   automated match to d2x6ca1
   complexed with ddq, k, m1m, tmo; mutant

Details for d6o9vb1

PDB Entry: 6o9v, 3.09 Å

PDB Description: kirbac3.1 mutant at a resolution of 3.1 angstroms

PDB Compounds: (B:) Inward rectifier potassium channel Kirbac3.1

SCOPe Domain Sequences for d6o9vb1:

Sequence, based on SEQRES records:

>d6o9vb1 f.14.1.0 (B:11-137) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
vgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealvgmlglavaacl
iyarctr

Sequence, based on observed residues (ATOM records):

>d6o9vb1 f.14.1.0 (B:11-137) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
kprilnsdgssnitrlglelddhyhdlltvswpvfitlitglylvtnalfalaylavgdv
ienarpgsftdafffsvqtmatigygklipigplantlvtlealvgmlglavaacliyar
ctr

Timeline for d6o9vb1:

• d6o9vb1 first appeared in SCOPe 2.07