SCOPe 2.07: Domain d6kz0f_: 6kz0 F:

Lineage for d6kz0f_ (6kz0 F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d6kz0f_: 6kz0 F: [386146]
   Other proteins in same PDB: d6kz0a1, d6kz0a2, d6kz0b_, d6kz0d1, d6kz0d2, d6kz0e_, d6kz0g1, d6kz0g2, d6kz0h_, d6kz0j1, d6kz0j2, d6kz0k_
   automated match to d1igml_

Details for d6kz0f_

PDB Entry: 6kz0, 2.4 Å

PDB Description: hrv14 3c in complex with single chain antibody ggvv

PDB Compounds: (F:) GGVV L chain

SCOPe Domain Sequences for d6kz0f_:

Sequence; same for both SEQRES and ATOM records:

>d6kz0f_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgisnylawyqqkpgkvpklliyaastlqsgvps
rfsgsgsgtdftltisslqpedvatyycqkynsapltfgqgtkvdik

Timeline for d6kz0f_:

• d6kz0f_ is new in SCOPe 2.07-stable
  
• d6kz0f_ appears in the current release, SCOPe 2.08