SCOPe 2.07: Domain d6lumq1: 6lum Q:23-132

Lineage for d6lumq1 (6lum Q:23-132)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Mycolicibacterium smegmatis [TaxId:1445611] [386130] (1 PDB entry)

8. Domain d6lumq1: 6lum Q:23-132 [386140]
   Other proteins in same PDB: d6lumb2, d6lumk2, d6lumq2
   automated match to d2wdqb1
   complexed with cdl, f3s, fad, fes, hem, lpp, mq9, pev, pie, sf4

Details for d6lumq1

PDB Entry: 6lum, 2.84 Å

PDB Description: structure of mycobacterium smegmatis succinate dehydrogenase 2

PDB Compounds: (Q:) Succinate dehydrogenase subunit B

SCOPe Domain Sequences for d6lumq1:

Sequence; same for both SEQRES and ATOM records:

>d6lumq1 d.15.4.0 (Q:23-132) automated matches {Mycolicibacterium smegmatis [TaxId: 1445611]}
avmvtlkiarfnpenpdaagwqsfrvpclpsdrllnllhyvkwyldgtltfrrscahgvc
gsdamringvnrlackvlmrdmlpknpnkqltitiepirglpvekdlvvn

Timeline for d6lumq1:

• d6lumq1 is new in SCOPe 2.07-stable
  
• d6lumq1 appears in the current release, SCOPe 2.08