Lineage for d6lumb1 (6lum B:23-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541309Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2541310Protein automated matches [191164] (24 species)
    not a true protein
  7. 2541372Species Mycolicibacterium smegmatis [TaxId:1445611] [386130] (1 PDB entry)
  8. 2541373Domain d6lumb1: 6lum B:23-132 [386138]
    Other proteins in same PDB: d6lumb2, d6lumk2, d6lumq2
    automated match to d2wdqb1
    complexed with cdl, f3s, fad, fes, hem, lpp, mq9, pev, pie, sf4

Details for d6lumb1

PDB Entry: 6lum (more details), 2.84 Å

PDB Description: structure of mycobacterium smegmatis succinate dehydrogenase 2
PDB Compounds: (B:) Succinate dehydrogenase subunit B

SCOPe Domain Sequences for d6lumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lumb1 d.15.4.0 (B:23-132) automated matches {Mycolicibacterium smegmatis [TaxId: 1445611]}
avmvtlkiarfnpenpdaagwqsfrvpclpsdrllnllhyvkwyldgtltfrrscahgvc
gsdamringvnrlackvlmrdmlpknpnkqltitiepirglpvekdlvvn

SCOPe Domain Coordinates for d6lumb1:

Click to download the PDB-style file with coordinates for d6lumb1.
(The format of our PDB-style files is described here.)

Timeline for d6lumb1: