| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
| Protein automated matches [191164] (24 species) not a true protein |
| Species Mycolicibacterium smegmatis [TaxId:1445611] [386130] (1 PDB entry) |
| Domain d6lumb1: 6lum B:23-132 [386138] Other proteins in same PDB: d6lumb2, d6lumk2, d6lumq2 automated match to d2wdqb1 complexed with cdl, f3s, fad, fes, hem, lpp, mq9, pev, pie, sf4 |
PDB Entry: 6lum (more details), 2.84 Å
SCOPe Domain Sequences for d6lumb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lumb1 d.15.4.0 (B:23-132) automated matches {Mycolicibacterium smegmatis [TaxId: 1445611]}
avmvtlkiarfnpenpdaagwqsfrvpclpsdrllnllhyvkwyldgtltfrrscahgvc
gsdamringvnrlackvlmrdmlpknpnkqltitiepirglpvekdlvvn
Timeline for d6lumb1:
View in 3DDomains from other chains: (mouse over for more information) d6lumk1, d6lumk2, d6lumq1, d6lumq2 |