| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.0: automated matches [230426] (1 protein) not a true family |
| Protein automated matches [230427] (2 species) not a true protein |
| Species Mycolicibacterium smegmatis [TaxId:1445611] [386132] (1 PDB entry) |
| Domain d6lumk2: 6lum K:133-260 [386133] Other proteins in same PDB: d6lumb1, d6lumk1, d6lumq1 automated match to d2wdqb2 complexed with cdl, f3s, fad, fes, hem, lpp, mq9, pev, pie, sf4 |
PDB Entry: 6lum (more details), 2.84 Å
SCOPe Domain Sequences for d6lumk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lumk2 a.1.2.0 (K:133-260) automated matches {Mycolicibacterium smegmatis [TaxId: 1445611]}
mepffdayravkpflvtsgnpptkeriqsptdraryddttkcilcaccttscpvywsegs
yfgpaaivnahrfifdsrdeaaaerldilnevdgvwrcrttfncteacprgiqvtqaiqe
vkralmfa
Timeline for d6lumk2:
View in 3DDomains from other chains: (mouse over for more information) d6lumb1, d6lumb2, d6lumq1, d6lumq2 |