SCOPe 2.08: Domain d6lumk2: 6lum K:133-260

Lineage for d6lumk2 (6lum K:133-260)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.0: automated matches [230426] (1 protein)
   not a true family

6. Protein automated matches [230427] (2 species)
   not a true protein

7. Species Mycolicibacterium smegmatis [TaxId:1445611] [386132] (1 PDB entry)

8. Domain d6lumk2: 6lum K:133-260 [386133]
   Other proteins in same PDB: d6lumb1, d6lumk1, d6lumq1
   automated match to d2wdqb2
   complexed with cdl, f3s, fad, fes, hem, lpp, mq9, pev, pie, sf4

Details for d6lumk2

PDB Entry: 6lum, 2.84 Å

PDB Description: structure of mycobacterium smegmatis succinate dehydrogenase 2

PDB Compounds: (K:) Succinate dehydrogenase subunit B

SCOPe Domain Sequences for d6lumk2:

Sequence; same for both SEQRES and ATOM records:

>d6lumk2 a.1.2.0 (K:133-260) automated matches {Mycolicibacterium smegmatis [TaxId: 1445611]}
mepffdayravkpflvtsgnpptkeriqsptdraryddttkcilcaccttscpvywsegs
yfgpaaivnahrfifdsrdeaaaerldilnevdgvwrcrttfncteacprgiqvtqaiqe
vkralmfa

Timeline for d6lumk2:

• d6lumk2 first appeared in SCOPe 2.07