SCOPe 2.08: Domain d7bywa_: 7byw A:

Lineage for d7bywa_ (7byw A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Acidovorax avenae [TaxId:643561] [386094] (2 PDB entries)

8. Domain d7bywa_: 7byw A: [386124]
   automated match to d1x8da1
   complexed with 1pg, fuc

Details for d7bywa_

PDB Entry: 7byw, 1.75 Å

PDB Description: crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose- bound form)

PDB Compounds: (A:) l-fucose mutarotase

SCOPe Domain Sequences for d7bywa_:

Sequence; same for both SEQRES and ATOM records:

>d7bywa_ d.58.4.0 (A:) automated matches {Acidovorax avenae [TaxId: 643561]}
qrmgmvigikpehideykrlhaavwpavlarlaeahvrnysiflrepenllfgyweyhgt
dyaadmeaiaqdpetrrwwtfcgpcqeplasrqpgehwahmeevfhvd

Timeline for d7bywa_:

• d7bywa_ first appeared in SCOPe 2.07