Lineage for d6kuca1 (6kuc A:77P-328)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2802457Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2802458Protein automated matches [190954] (13 species)
    not a true protein
  7. 2802517Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256045] (4 PDB entries)
  8. 2802520Domain d6kuca1: 6kuc A:77P-328 [386108]
    Other proteins in same PDB: d6kuca2
    automated match to d3qvca_
    complexed with gol, peg

Details for d6kuca1

PDB Entry: 6kuc (more details), 2.5 Å

PDB Description: crystal structure of plasmodium falciparum histo-aspartic protease (hap) zymogen (form 2)
PDB Compounds: (A:) HAP protein

SCOPe Domain Sequences for d6kuca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kuca1 b.50.1.0 (A:77P-328) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kystvgfniensydrlmktikehklknyikesvklfnkgltkksylgsefdnvelkdlan
vlsfgeaklgdngqkfnflfhtassnvwvpsikctsescesknhydssksktyekddtpv
kltskagtisgifskdlvtigklsvpykfiemteivgfepfysesdvdgvfglgwkdlsi
gsidpyivelktqnkieqavysiylppenknkgyltiggieerffdgplnyeklnhdlmw
qvdldvhfgnvsskkanvildsatsvitvpteffnqfvesasvfkvpflslyvttcgntk
lptleyrspnkvytlepkqyleplenifsalcmlnivpidlekntfvlgdpfmrkyftvy
dydnhtvgfalaknl

SCOPe Domain Coordinates for d6kuca1:

Click to download the PDB-style file with coordinates for d6kuca1.
(The format of our PDB-style files is described here.)

Timeline for d6kuca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6kuca2