SCOPe 2.08: Domain d6yvte_: 6yvt E:

Lineage for d6yvte_ (6yvt E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
   Pfam PF13640; PubMed 16782814

6. Protein automated matches [254532] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255179] (35 PDB entries)

8. Domain d6yvte_: 6yvt E: [386075]
   automated match to d3ouja_
   protein/DNA complex; complexed with gol, mn, pw2, so4

Details for d6yvte_

PDB Entry: 6yvt, 2.85 Å

PDB Description: hif prolyl hydroxylase 2 (phd2/ egln1) in complex with md-253

PDB Compounds: (E:) Egl nine homolog 1

SCOPe Domain Sequences for d6yvte_:

Sequence, based on SEQRES records:

>d6yvte_ b.82.2.15 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds
skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgng
tgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw
sdrrnphevqpayatryaitvwyfdaderarakvky

Sequence, based on observed residues (ATOM records):

>d6yvte_ b.82.2.15 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtkitwiegkepgceti
gllmssmddlirhcngklgsykingrtkamvacypgngtgyvrhvdnpngdgrcvtciyy
lnkdwdakvsggilrifpegkaqfadiepkfdrllffwsdrrnphevqpayatryaitvw
yfdaderarakvky

Timeline for d6yvte_:

• d6yvte_ first appeared in SCOPe 2.07