SCOPe 2.08: Domain d6w9ac_: 6w9a C:

Lineage for d6w9ac_ (6w9a C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens) [TaxId:9606] [385992] (1 PDB entry)

8. Domain d6w9ac_: 6w9a C: [386032]
   automated match to d1qcqa_
   complexed with gol, zn

Details for d6w9ac_

PDB Entry: 6w9a, 2.3 Å

PDB Description: rnf12 ring domain in complex with ube2e2

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 E2

SCOPe Domain Sequences for d6w9ac_:

Sequence; same for both SEQRES and ATOM records:

>d6w9ac_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens) [TaxId: 9606]}
ktaaklstsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvffld
itfspdypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdc
npadplvgsiatqymtnraehdrmarqwtkryat

Timeline for d6w9ac_:

• d6w9ac_ first appeared in SCOPe 2.07