SCOPe 2.07: Domain d6wvrd1: 6wvr D:1-245

Lineage for d6wvrd1 (6wvr D:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)

8. Domain d6wvrd1: 6wvr D:1-245 [386018]
   Other proteins in same PDB: d6wvra2, d6wvrb2, d6wvrc2, d6wvrd2
   automated match to d4drxb1
   complexed with gdp, gtp, mg, ta1

Details for d6wvrd1

PDB Entry: 6wvr, 2.9 Å

PDB Description: tubulin dimers from a 13-protofilament, taxol stabilized microtubule

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d6wvrd1:

Sequence; same for both SEQRES and ATOM records:

>d6wvrd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6wvrd1:

• d6wvrd1 is new in SCOPe 2.07-stable
  
• d6wvrd1 appears in the current release, SCOPe 2.08