Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (40 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [385968] (2 PDB entries) |
Domain d6yehe1: 6yeh E:2-175 [386013] Other proteins in same PDB: d6yeha2, d6yehb2, d6yehc2, d6yehd2, d6yehe2, d6yehf2 automated match to d3k92b1 complexed with k, mpd |
PDB Entry: 6yeh (more details), 2.59 Å
SCOPe Domain Sequences for d6yehe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yehe1 c.58.1.0 (E:2-175) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} nalaatnrnfklaarllgldskleksllipfreikvectipkddgtlasfvgfrvqhdna rgpmkggiryhpevdpdevnalaqlmtwktavakipyggakggigcdpsklsiselerlt rvftqkihdligihtdvpapdmgtgpqtmawildeyskfhgyspavvtgkpidl
Timeline for d6yehe1: