SCOPe 2.08: Domain d6yehf2: 6yeh F:176-411

Lineage for d6yehf2 (6yeh F:176-411)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries)

8. Domain d6yehf2: 6yeh F:176-411 [386004]
   Other proteins in same PDB: d6yeha1, d6yehb1, d6yehc1, d6yehd1, d6yehe1, d6yehf1
   automated match to d3k92a2
   complexed with k, mpd

Details for d6yehf2

PDB Entry: 6yeh, 2.59 Å

PDB Description: arabidopsis thaliana glutamate dehydrogenase isoform 1 in apo form

PDB Compounds: (F:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d6yehf2:

Sequence; same for both SEQRES and ATOM records:

>d6yehf2 c.2.1.0 (F:176-411) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ggslgrdaatgrgvmfgteallnehgktisgqrfviqgfgnvgswaaklisekggkivav
sditgaiknkdgidipallkhtkehrgvkgfdgadpidpnsilvedcdilvpaalggvin
renaneikakfiieaanhptdpdadeilskkgvvilpdiyansggvtvsyfewvqniqgf
mweeekvndelktymtrsfkdlkemckthscdlrmgaftlgvnrvaqatilrgwga

Timeline for d6yehf2:

• d6yehf2 first appeared in SCOPe 2.07