Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (14 PDB entries) |
Domain d6yehf2: 6yeh F:176-411 [386004] Other proteins in same PDB: d6yeha1, d6yehb1, d6yehc1, d6yehd1, d6yehe1, d6yehf1 automated match to d3k92a2 complexed with k, mpd |
PDB Entry: 6yeh (more details), 2.59 Å
SCOPe Domain Sequences for d6yehf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yehf2 c.2.1.0 (F:176-411) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ggslgrdaatgrgvmfgteallnehgktisgqrfviqgfgnvgswaaklisekggkivav sditgaiknkdgidipallkhtkehrgvkgfdgadpidpnsilvedcdilvpaalggvin renaneikakfiieaanhptdpdadeilskkgvvilpdiyansggvtvsyfewvqniqgf mweeekvndelktymtrsfkdlkemckthscdlrmgaftlgvnrvaqatilrgwga
Timeline for d6yehf2: