SCOP 1.67: Domain d1qapb2: 1qap B:8-129

Lineage for d1qapb2 (1qap B:8-129)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain [54675] (1 family)

5. Family d.41.2.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain [54676] (1 protein)

6. Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain [54677] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [54678] (1 PDB entry)

8. Domain d1qapb2: 1qap B:8-129 [38596]
   Other proteins in same PDB: d1qapa1, d1qapb1
   complexed with ntm

Details for d1qapb2

PDB Entry: 1qap, 2.8 Å

PDB Description: quinolinic acid phosphoribosyltransferase with bound quinolinic acid

SCOP Domain Sequences for d1qapb2:

Sequence; same for both SEQRES and ATOM records:

>d1qapb2 d.41.2.1 (B:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium}
ddrrdallerinldipaavaqalredlggevdagnditaqllpadtqahatvitredgvf
cgkrwveevfiqlagddvrltwhvddgdaihanqtvfelqgparvlltgertalnfvqtl
sg

Timeline for d1qapb2:

• d1qapb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qapb2 appears in SCOP 1.65
  
• d1qapb2 appears in SCOP 1.69
  
• d1qapb2 appears in the current release, SCOPe 2.08