Lineage for d6proa1 (6pro A:1-90)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303798Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303799Protein automated matches [226859] (38 species)
    not a true protein
  7. 2303891Species Geobacillus stearothermophilus [TaxId:1422] [385845] (1 PDB entry)
  8. 2303892Domain d6proa1: 6pro A:1-90 [385929]
    Other proteins in same PDB: d6proa2, d6prob2
    automated match to d1idsa1
    complexed with mn

Details for d6proa1

PDB Entry: 6pro (more details), 2.26 Å

PDB Description: mnsod from geobacillus stearothermophilus
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6proa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6proa1 a.2.11.0 (A:1-90) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
pfelpalpypydalephidketmnihhtkhhntyvtnlnaaleghpdlqnksleellsnl
ealpesirtavrnnggghanhslfwtilsp

SCOPe Domain Coordinates for d6proa1:

Click to download the PDB-style file with coordinates for d6proa1.
(The format of our PDB-style files is described here.)

Timeline for d6proa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6proa2