Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (38 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [385845] (1 PDB entry) |
Domain d6proa1: 6pro A:1-90 [385929] Other proteins in same PDB: d6proa2, d6prob2 automated match to d1idsa1 complexed with mn |
PDB Entry: 6pro (more details), 2.26 Å
SCOPe Domain Sequences for d6proa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6proa1 a.2.11.0 (A:1-90) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} pfelpalpypydalephidketmnihhtkhhntyvtnlnaaleghpdlqnksleellsnl ealpesirtavrnnggghanhslfwtilsp
Timeline for d6proa1: