Lineage for d1ffvb1 (1ffv B:7-146)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256251Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 256252Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 256253Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 256259Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 256260Species Hydrogenophaga pseudoflava [TaxId:47421] [54674] (2 PDB entries)
  8. 256261Domain d1ffvb1: 1ffv B:7-146 [38591]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffvd2, d1ffve2, d1ffvf1, d1ffvf2

Details for d1ffvb1

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvb1 d.41.1.1 (B:7-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Hydrogenophaga pseudoflava}
daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
adaveavkveydelpvvidp

SCOP Domain Coordinates for d1ffvb1:

Click to download the PDB-style file with coordinates for d1ffvb1.
(The format of our PDB-style files is described here.)

Timeline for d1ffvb1: